PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G149300.1
Common NamePHAVU_005G149300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 744aa    MW: 85034.7 Da    PI: 7.249
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G149300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.34.8e-2729114291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fY+eYAk++GF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk+++dgkw+v+++++eHnHel p
  Phvul.005G149300.1  29 FYKEYAKSAGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRQDGKWYVYSFVKEHNHELLP 114
                         9***************************************999877....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-2429114IPR004330FAR1 DNA binding domain
PfamPF105517.0E-28227320IPR018289MULE transposase domain
PfamPF044341.8E-8506540IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.46506542IPR007527Zinc finger, SWIM-type
SMARTSM005758.2E-9517544IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MDSSAIVGSS ISEPHHDMEF ESHEAAYAFY KEYAKSAGFG TAKLSSRRSR ASKEFIDAKF  60
SCIRYGNKQQ SDDAINPRPS PKIGCKASMH VKRRQDGKWY VYSFVKEHNH ELLPAQAHFF  120
RSHRSSDPLG NDVRMRRRKT SNAVSKLFSA YQNVDCLENF VKHQHDKGRS LVLEAGHAQL  180
LLELFMHMQE ENPKFFYAVD LNEEHRLRNV FWVDAKGLEN FTYFSDVVSF DTTYFTSKYK  240
IPLVLFVGVN HHIQPTLLGC ALIADETIFT YAWLLQTWLI AMGERAPQVL LTDQNDAIKA  300
AVATFLPGTR HCFCLWHILE KIPKQLQILG AWHDSFMEKF NKCIFRSWTE EQFEKRWWKL  360
VDSFSLGDVE WIRSLYDDRT CWVPTFMKDI SFAGLSTSSR SESLNSLLDN YIHVDSSLRE  420
FIEQYRVILE DRHEEEAKAN FDAWHETPDL KSPSPFEKQM LLVYTHEIFR KFQVEVLGAA  480
ACHLKKESDG VTTTYTVKDF ENSQNYLVEW NMSASDICCS CRLFEYKGYL CRHAIVVLQM  540
SGVFSIPPKY ILQRWTNAAM SRHPIGEKLE VVQSKVRRFN DLCRRAIILG EEGSLSPESY  600
YMALGAISEA LKQCVNLNNP VENGMRPDAS CTHVVCNVEE EYQSIITSNH KVPDPKLNMG  660
KKAVRIGVAC RSQGGVENSG GDKGKVSLVE AGSAKDGFQH MELTDPRSQG VMAMQFHNVV  720
PALFHNVSAP FHTAPSPHMH ENR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134139MRRRKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150391.10.0hypothetical protein PHAVU_005G149300g
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLV7BZA10.0V7BZA1_PHAVU; Uncharacterized protein
STRINGGLYMA13G41660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.20.0FAR1-related sequence 4